 |
|
Elevated Levels of Antibody to Myelin Oligodendrocyte Glycoprotein Is Not Specific for Patients With Multiple Sclerosis
Arnon Karni, MD;
Ronit Bakimer-Kleiner, PhD;
Oded Abramsky, MD, PhD;
Avraham Ben-Nun, PhD
Arch Neurol. 1999;56:311-315.
ABSTRACT
| |
Objective To evaluate the presence and specificity of anti–myelin oligodendrocyte glycoprotein (MOG) antibody in the cerebrospinal fluid and plasma of patients with multiple sclerosis (MS).
Design Case-control study of patients with clinically definite MS compared with patients with other neurologic diseases (ONDs) of the central nervous system and control subjects.
Setting Referral center in the Department of Neurology of Hadassah University Hospital, greater Jerusalem area, Israel.
Participants Consecutive cerebrospinal fluid samples from 31 patients with MS, 31 patients with ONDs, and 28 healthy controls; and plasma samples from 33 patients with MS, 28 patients with ONDs, and 31 healthy controls were taken from the cerebrospinal fluid and plasma bank of the Department of Neurology, Hadassah University Hospital.
Main Outcome Measures Levels and frequencies of anti-MOG antibody in patients with MS, as defined by enzyme-linked immunosorbent assay.
Results Cerebrospinal fluid levels of antibodies to MOG and to myelin basic protein were significantly higher in patients with MS (P<.001 and P=.001, respectively) and patients with ONDs (P=.005 and P=.03, respectively) compared with controls; frequency of antibodies to MOG, but not to myelin basic protein, was higher in patients with MS and patients with ONDs (P=.01 and P=.003, respectively, for the frequency of anti-MOG antibody, and P=.65 and P=.41, respectively, for the frequency of anti-myelin basic protein antibody). Plasma levels of antibodies to MOG and to myelin basic protein were higher in patients with MS compared with patients with ONDs (P=.003 for both comparisons) and with controls (P=.03 and P=.04, respectively); however, the frequency of antibodies to MOG and myelin basic protein was similar in patients with MS, patients with ONDs (P=.54 and P=.82, respectively), and controls (P=.50 and P=.14, respectively).
Conclusions The elevated presence of anti-MOG antibody is not specific for MS because a similar appearance was also demonstrated in patients with ONDs. Therefore, it is not clear whether this antibody is pathogenic in MS or, on the contrary, has a defensive role against further immune-mediated damage after myelin breakdown.
INTRODUCTION
MULTIPLE SCLEROSIS (MS) is an acquired and chronic white matter disease of presumed autoimmune pathogenesis. Results of pathologic studies1-4 of the disease and of the animal model—experimental autoimmune encephalomyelitis—emphasize mainly a T-cell basis for an inflammatory reaction of demyelinating plaques. However, beyond the well-known intrathecal overproduction of immunoglobulins in patients with MS,5 there is also clear evidence of humoral immune activity in these plaques.6-7 Results of previous studies8-10 of the frequency of antibodies against myelin oligodendrocyte antigens, such as myelin basic protein (MBP) and galactocerebrosidase in serum and cerebrospinal fluid (CSF), show that elevated titers of these antibodies are not specific for MS. This raises the dilemma of whether these antibodies are deleterious or play a defensive role against further autoimmune attack after myelin breakdown.11
Myelin oligodendrocyte glycoprotein (MOG) is a minor component of myelin proteins12 that is restricted to the central nervous system (CNS)13-16 and is located in the outermost region of the myelin sheath.14, 17-18 Results of several investigations4, 19 suggest this antigen may be a primary target of the humoral autoimmune process in MS. Anti-MOG antibody—but not antibodies against other myelin proteins—was capable of causing demyelination in brain cell cultures.20 Anti-MOG antibody injected intrathecally into healthy rats and intravenously into animals with experimental autoimmune encephalomyelitis resulted in new and enlarged demyelinative plaques, respectively.17, 21-23 Moreover, in chronic relapsing experimental autoimmune encephalomyelitis, serum demyelinating activity correlated with the anti-MOG antibody titer;24 in a nonhuman primate model of experimental autoimmune encephalomyelitis induced by MOG, exacerbations correlated with an enhanced production of anti-MOG antibody.25
Patients with MS had higher titers of CSF anti-MOG antibody, and more anti-MOG IgG antibody-secreting cells, in CSF and blood than did controls.26-27 To evaluate whether the presence of anti-MOG antibody is specific to MS, we compared the levels of CSF and plasma anti-MOG antibody in patients with MS and the frequencies of patients with MS positive for this antibody with those of patients with other neurologic diseases (ONDs) of the CNS and healthy control subjects. We also compared the frequencies of anti-MOG antibody with those of anti-MBP antibody in the same groups.
PATIENTS, MATERIALS, AND METHODS
PATIENTS
Samples of CSF and plasma were obtained from 31 and 33 patients with clinically definite28 MS, respectively. Clinical and laboratory data are presented in Table 1.
|
|
|
|
Table 1. Clinical and Laboratory Data for Patients With MS, Patients With ONDs, and Controls*
|
|
|
Cerebrospinal fluid samples were also obtained from 31 patients with ONDs of the CNS and from 28 controls who were examined for headache. The ONDs group included 6 patients with degenerative dementia, 3 patients with primary CNS lymphoma, 3 patients with Behçet disease, 3 patients with acute meningitis, 3 patients with motor neuron disease, 2 patients with multisystem atrophy, 2 patients with extrapyramidal syndromes, 2 patients with acute encephalitis, 2 patients with intracerebral hemorrhage, 1 patient with acute cerebral infarct, l patient with Wilson disease, 1 patient with type C Niemann-Pick disease, 1 patient with focal epilepsy, and l patient with Friedreich ataxia.
Plasma samples were also obtained from 31 healthy individuals and 28 patients with ONDs of the CNS (Table 1). The latter comprised 11 patients with acute cerebral infarct, 3 patients with intracerebral hemorrhage, 2 patients with degenerative dementia, 2 patients with cryptogenic generalized epilepsy, 2 patients with Behçet disease, 2 patients with brain vasculitis, 2 patients with acute encephalitis, 1 patient with acute meningitis, 1 patient with Wilson disease, 1 patient with type C Niemann-Pick disease, and 1 patient with Sydenham chorea. None of the participants were being treated with immunosuppressive or immunomodulatory drugs during CSF or blood sampling.
ANTIGENS
Human MOG, a recombinant MOG that represents the immunoglobulinlike domain of the MOG molecule, was prepared as described previously.31 The specific peptide sequence is GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEV-
GWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKD-
AIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAME-
LKVEDPFYWVS.
Human MBP was purified from neurologically healthy human brain according to Dunkley and Carnegie.32
ANTIBODY DETERMINATION
Cerebrospinal fluid and plasma samples were tested for levels of anti-MOG and anti-MBP antibodies of the IgA, IgG, and IgM isotypes. The CSF levels were measured by a modified enzyme-linked immunosorbent assay with avidin-biotin amplification12 and the plasma levels were measured using standard enzyme-linked immunosorbent assay. Briefly, 96-well microtiter plates (Nunc-Immuno plates; Nunc Als, Roskilde, Denmark) were coated with 100 µL of a 10-µg/mL antigen (recombinant human MOG or MBP) solution in phosphate-buffered saline solution (PBS), pH 7.4, overnight at 4°C. Unreactive sites were saturated with 10% filtered fetal calf serum (150 µL) in carbonate buffer, pH 9.6, for 2 hours at 37°C. A 75-µL volume of CSF (diluted 1:5 in PBS with 1% bovine serum albumin [BSA] and 0.05% Tween-20) or plasma (diluted 1:200 in the same solution) was added to each well, and the plates were kept at room temperature for 1 hour. After washing, goat biotinylated antihuman IgG (75 µL), diluted 1:4000 in PBS and 3% BSA or antihuman IgA, IgG and IgM conjugated to peroxidase (75 µL), diluted 1:2000 in PBS and 1% BSA and 0.05% Tween-20 were added to each well of the tested CSF and plasma samples, respectively, and the plates were incubated for an additional 2 hours at room temperature. Bovine serum albumin was included to reduce nonspecific binding. The CSF plates were washed again, then peroxidase (75 µL) that was conjugated to streptavidin and diluted 1:2000 in PBS and 1% BSA was added to each well, and the plates were incubated for 30 minutes at 37°C. Afterward, all plates were washed and a 2,2'-Azinobis (3-ethylbenzthiazoline-sulfonic acid) (ABTS; Sigma-Aldrich Corp, St Louis, Mo) substrate was added. The developing color was read as an optical density at 405 nm (OD405). Each CSF and plasma specimen was tested in duplicate (2 samples), so the results for every specimen express the average value of the OD readings. The within-assay variation was consistently less than 15%. Specimens were considered positive if their average OD reading was higher than the mean OD405 level +2 SDs of controls. Results of preliminary tests done twice with 30 patients with MS, 20 patients with ONDs, and 10 controls show a complete matching of positive specimens for anti-MOG antibodies.
CSF OLIGOCLONAL BANDS
Cerebrospinal fluid oligoclonal bands were detected by electrophoresis of unconcentrated CSF on agarose gel (Panagel; Princeton Separations Inc, Freehold, NJ) slides, followed by fixation using picric acid, drying, and staining with amido black.
CSF IgG CONCENTRATIONS
The CSF IgG concentrations of patients with MS, patients with ONDs, and controls were measured in immunodiffusion plates (Behringwerke AG, Marburg, Germany). Measurement was done to check whether the anti-MOG and anti-MBP levels obtained were specific for the antigen tested or were attributable to the total IgG concentrations.
STATISTICAL ANALYSIS
Comparisons were made among patients with MS, patients with ONDs, and controls for anti-MOG and anti-MBP antibody levels and for CSF IgG concentrations using the Wilcoxon rank sum test. Comparisons of the frequency of positive patients were made with Yates corrected  2 test. P<.05 was considered significant.
RESULTS
Levels of anti-MOG and anti-MBP antibodies were determined in CSF and plasma samples from patients with MS, patients with ONDs, and controls. We compared overall values of the antibodies and frequency of positive patients. The cutoff value above which patients were considered positive for CSF antibodies was set as the mean value for controls +2 SDs: 0.781 OD405 for the anti-MOG antibody and 1.070 OD405 for the anti-MBP antibody. The cutoff value above which patients were considered positive for plasma antibodies was set as the mean value for controls +2 SDs: 0.451 OD405 for the anti-MOG antibody and 0.554 OD405 for the anti-MBP antibody.
As shown in Table 2, CSF levels of anti-MOG and anti-MBP antibodies of patients with MS and patients with ONDs were significantly higher than those of controls. However, only the frequency of patients who were positive for the anti-MOG antibody (but not for the anti-MBP antibody) was higher in the MS and ONDs groups than in controls. There were no significant differences in anti-MOG and anti-MBP antibody levels between the MS and ONDs groups.
|
|
|
|
Table 2. Anti-MOG and Anti-MBP Antibody Levels in the CSF of Patients With MS, Patients With ONDs of the CNS, and Controls*
|
|
|
Plasma levels of anti-MOG and anti-MBP antibodies of patients with MS were significantly higher than those of patients with ONDs and controls (Table 3). There were no significant differences in percentage of patients who were positive for anti-MOG or anti-MBP antibodies among patients with MS, patients with ONDs, and controls.
|
|
|
|
Table 3. Anti-MOG and Anti-MBP Antibody Levels in the Plasma of Patients With MS, Patients With ONDs of the CNs, and Controls*
|
|
|
To check whether the differences in levels of CSF antibodies can be attributed to levels of CSF immunoglobulins, we measured CSF IgG concentrations. Range of CSF IgG concentrations in patients with MS was 0.002 to 0.15 g/L (mean, 0.05 g/L). Mean CSF IgG concentration of the 10 anti-MOG antibody–positive patients with MS was 0.06 g/L, whereas mean CSF IgG concentrations of the 21 anti-MOG antibody–negative patients with MS was 0.06 g/L. There was no significant difference between these 2 subgroups of patients with MS.
Range of CSF IgG concentrations in patients with ONDs was 0.002 to 0.12 g/L (mean, 0.03 g/L). Mean CSF IgG concentrations of the 12 anti-MOG antibody–positive patients with ONDs was 0.04 g/L, whereas mean CSF IgG concentrations of the 19 anti-MOG antibody–negative patients with ONDs was 0.04 g/L. There was no significant difference in IgG concentration between these 2 subgroups of patients with ONDs.
Similarly, no significant difference in anti-MOG and anti-MBP antibodies was found between 19 patients with MS with CSF oligoclonal bands and 12 patients with MS without CSF oligoclonal bands.
Because the relative frequency of immunoglobulin-producing B cells and plasma cells is higher in the late stages of MS,33 we analyzed the levels and frequencies of anti-MOG and anti-MBP in patients with MS according to disease course (relapsing-remitting vs secondary progressive), degree of disability (evaluated by the Expanded Disability Status Scale of Kurtzke30), and disease duration. No significant differences in the levels and frequencies of CSF anti-MOG and anti-MBP antibodies were noted on the basis of the above-mentioned clinical features of MS. However, 50% (6/12) of the patients with MS with a disease duration of 5 years or more were positive for the anti-MOG antibody compared with only 21% (4/19) of the patients with MS with a disease duration of less than 5 years (P=.20).
Similar to the CSF, no significant differences in the levels and frequencies of the plasma anti-MOG and anti-MBP antibodies were found by subdividing the patients with MS according to disease course, degree of disability, or disease duration.
COMMENT
In light of the assumption that the anti-MOG antibody participates in the pathogenesis of demyelination in MS, and may serve as a diagnostic tool for this disease, we compared the occurrence of this antibody in patients with MS, patients with ONDs, and controls. The levels of anti-MOG antibody and the frequencies of patients positive to this antibody were also compared with those of anti-MBP antibody, which is known to be elevated nonspecifically in patients with MS. Our main finding is that patients with MS had higher CSF anti-MOG and anti-MBP antibody levels than controls. However, only the percentage of anti-MOG antibody–positive patients was significantly higher in patients with MS compared with controls. Furthermore, this difference was not specific to MS because patients with ONDs showed a similar pattern of anti-MOG antibody levels and frequencies of positive patients.
There was no correlation between CSF anti-MOG antibody levels and CSF IgG concentrations. This result indicated that the detected antibodies were specific for the antigens we tested.
Although the plasma levels of the anti-MOG and anti-MBP antibodies of patients with MS were significantly higher than the antibody levels of patients with ONDs and controls, these levels were usually not higher than the cutoff value for controls.
Anti-MOG antibody has been suggested to be involved in the formation of demyelinative MS plaques.14-18 However, we found that this antibody was also present in ONDs with no demyelinating lesions. Therefore, our study shows that measuring anti-MOG antibody cannot serve as a diagnostic tool for MS and does not support the notion that anti-MOG antibody is primarily responsible for demyelination in MS.
Our findings support the possibility that increased levels of anti-MOG antibody in MS may represent a secondary phenomenon related to myelin damage in this disease. Taking into account its demyelinative property,17, 20-23 this antibody may be pathogenic in the setting of blood-brain barrier breach, complement, and inflammatory infiltrates that occur in acute MS lesions. However, it may serve as a defense line against immune-mediated damage after myelin breakdown11 by opsonization of myelin debris to allow phagocytosis by macrophages and microglial cells. Therefore, as with other MS nonspecific autoantibodies, the meaning of elevated anti-MOG antibody levels in CSF is not straightforward.
AUTHOR INFORMATION
Accepted for publication July 14, 1998.
This work was supported in part by the Hilda Katz Blaustein, the Zeev Aram, and the Lena P. Harvey endowment funds.
Corresponding author: Arnon Karni, MD, Department of Neurology, Hadassah University Hospital, PO Box 12000, Jerusalem 91120, Israel (e-mail: akarni{at}cc.huji.ac.il).
From the Department of Neurology, Hadassah University Hospital, Hebrew University Hadassah Medical School, Jerusalem (Drs Karni and Abramsky), and the Department of Immunology, The Weizmann Institute of Science, Rehovot (Drs Bakimer-Kleiner and Ben-Nun), Israel.
REFERENCES
| |
1. Cuzner ML, Hayes QM, Newcombe J, Woodroofe MN. The nature of inflammatory components during demyelination in multiple sclerosis. J Neuroimmunol. 1988;20:203-209.
FULL TEXT
|
ISI
| PUBMED
2. Boyle EA, McGeer PL. Cellular immune response in multiple sclerosis plaques. Am J Pathol. 1990;137:575-584.
ABSTRACT
3. Owens T, Sriram S. The immunology of multiple sclerosis and its animal model, experimental allergic encephalomyelitis. Neurol Clin. 1995;13:51-73.
ISI
| PUBMED
4. Kerlero de Rosbo N, Mendel I, Ben-Nun A. Chronic relapsing autoimmune encephalomyelitis with delayed onset and an atypical clinical course, induced in PL/J mice by myelin oligodendrocyte glycoprotein (MOG)–derived peptide: preliminary analysis of MOG T cell epitopes. Eur J Immunol. 1995;25:985-993.
ISI
| PUBMED
5. Ebers OC. Oligoclonal banding in MS. Ann N Y Acad Sci. 1984;436:206-212.
ISI
| PUBMED
6. Compston DA, Morgan BP, Campbell AK, et al. Immunocytochemical localization of terminal complement complex in multiple sclerosis. Neuropathol Appl Neurobiol. 1989;15:307-316.
ISI
| PUBMED
7. Prineas JW, Graham JS. Multiple sclerosis: capping of surface immunoglobulin G on macrophages engaged in myelin breakdown. Ann Neurol. 1981;10:149-158.
FULL TEXT
|
ISI
| PUBMED
8. Panitch HS, Hooper CJ, Johnson KP. CSF antibody to myelin basic protein: measurement in patients with multiple sclerosis and subacute sclerosing panencephalitis. Arch Neurol. 1980;37:206-209.
FREE FULL TEXT
9. Gorny MK, Wroblewska Z, Pleasure D, Miller SL, Wajgt A, Koprowski H. CSF antibodies to myelin basic protein and oligodendrocytes in multiple sclerosis and other neurological diseases. Acta Neurol Scand. 1983;67:338-347.
ISI
| PUBMED
10. Ichioka T, Uobe K, Stoskopf M, Kishimoto Y, Tennekoon G, Tourtellotte WW. Antigalactocerebrosidase antibodies in human cerebrospinal fluid determined by enzyme-linked immunosorbent assay (ELISA). Neurochem Res. 1988;13:203-207.
FULL TEXT
|
ISI
| PUBMED
11. Hunter SF, Rodriguez M. Multiple sclerosis: a unique immunopathological syndrome of the central nervous system. Springer Semin Immunopathol. 1995;17:89-105.
ISI
| PUBMED
12. Amiguet P, Gardinier MV, Zanetta JP, Matthieu JM. Purification and partial structural and functional characterization of mouse myelin/oligodendrocyte glycoprotein. J Neurochem. 1992;58:1676-1682.
ISI
| PUBMED
13. Linnington C, Webb M, Woodhams PL. A novel myelin-associated glycoprotein defined by a mouse monoclonal antibody. J Neuroimmunol. 1984;6:387-396.
FULL TEXT
|
ISI
| PUBMED
14. Lebar R, Lubetzki C, Vincent C, Lombrail P, Boutry JM. The M2 autoantigen of central nervous system myelin, a glycoprotein present in oligodendrocyte membrane. Clin Exp Immunol. 1986;66:423-434.
ISI
| PUBMED
15. Gardinier MV, Amiguet P, Linington C, Matthieu JM. Myelin/oligodendrocyte glycoprotein is a unique member of the immunoglobulin superfamily. J Neurosci Res. 1992;33:177-187.
FULL TEXT
|
ISI
| PUBMED
16. Pham-Dinh D, Mattei MG, Nussbaum JL, et al. Myelin/oligodendrocyte glycoprotein is a member of a subset of the immunoglobulin superfamily encoded within the major histocompatibility complex. Proc Natl Acad Sci U S A. 1993;90: 7990-7994.
17. Linnington C, Bradl M, Lassmann H, Brunner C, Vaas K. Augmentation of demyelination in rag acute allergic encephalomyelitis by circulating mouse monoclonal antibodies directed against a myelin/oligodendrocyte glycoprotein. Am J Pathol. 1988;130:443-454.
ABSTRACT
18. Scolding NJ, Frith S, Linington C, Morgan BP, Campbell AK, Compston DA. Myelin-oligodendrocyte glycoprotein (MOG) is a surface marker of oligodendrocyte maturation. J Neuroimmunol. 1989;22:169-176.
FULL TEXT
|
ISI
| PUBMED
19. Kerlero de Rosbo N, Hoffman M, Mendel I, et al. Predominance of the autoimmune response to myelin oligodendrocyte glycoprotein (MOG) in multiple sclerosis: reactivity to the extracellular domain of MOG is directed against three main regions. Eur J Immunol. 1997;27:3059-3069.
ISI
| PUBMED
20. Kerlero de Rosbo N, Honegger P, Lassmann H, Mathieu JM. Demyelination induced in aggregating brain cell cultures by monoclonal antibody against myelin/oligodendrocyte glycoprotein. J Neurochem. 1990;55:583-587.
ISI
| PUBMED
21. Lassmann H, Linington C. The role of antibodies against myelin surface antigens in demyelination in chronic EAE. In: Crescenzi GS, ed. A Multidisciplinary Approach to Myelin Diseases. New York, NY: Plenum Publishing Corp; 1987:219-225.
22. Schluesener HJ, Sobel RA, Linington C, Weiner HL. A monoclonal antibody against a myelin oligodendrocyte glycoprotein induces relapses and demyelination in central nervous system autoimmune disease. J Immunol. 1987;139:4016-4021.
ABSTRACT
23. Piddlesden SJ, Lassmann H, Zimprich F, Morgan BP, Linington C. The demyelinating potential of antibodies to myelin oligodendrocyte glycoprotein is related to their ability to fix complement. Am J Pathol. 1993;143:555-564.
ABSTRACT
24. Linington C, Lassmann H. Antibody responses in chronic relapsing experimental allergic encephalomyelitis: correlation of serum demyelinating activity with antibody titre to the myelin/oligodendrocyte glycoprotein (MOG). J Neuroimmunol. 1987;17:61-69.
FULL TEXT
|
ISI
| PUBMED
25. Oenain CP, Abel K, Belmar N, et al. Late complications of immune deviation therapy in a nonhuman primate. Science. 1996;274:2054-2057.
FREE FULL TEXT
26. Xiao BG, Linington C, Link H. Antibodies to myelin-oligodendrocyte glycoprotein in cerebrospinal fluid from patients with multiple sclerosis and controls. J Neuroimmunol. 1991;31:91-96.
FULL TEXT
|
ISI
| PUBMED
27. Sun J, Link H, Olsson T, et al. T and B cell responses to myelin-oligodendrocyte glycoprotein in multiple sclerosis. J Immunol. 1991;146:1490-1495.
ABSTRACT
28. Poser CM, Paty DW, Scheinberg L, et al. New diagnostic criteria for multiple sclerosis: guidelines for research protocols. Ann Neurol. 1983;13:227-231.
FULL TEXT
|
ISI
| PUBMED
29. Lublin FD, Reingold SC. Defining the clinical course of multiple sclerosis: results of an international survey. Neurology. 1996;46:907-911.
FREE FULL TEXT
30. Kurtzke JF. Rating neurologic impairment in multiple sclerosis: an Expanded Disability Status Scale (EDSS). Neurology. 1983;33:1444-1452.
FREE FULL TEXT
31. Abo S, Bernard C, Webb M, et al. Preparation of highly purified human myelin oligodendrocyte glycoprotein in quantities sufficient for encephalitogenicity and immunogenicity studies. Biochem Mol Biol Int. 1993;30:945-958.
ISI
| PUBMED
32. Dunkley PR, Carnegie PR. Isolation of myelin basic protein. In: Marks N, Rodnight R, ed. Research Methods in Neurochemistry. Vol. 2. New York, NY: Plenum Publishing Corp; 1974:219-245.
33. Ozawa K, Suchanek G, Breitschopf H, et al. Patterns of oligodendroglia pathology in multiple sclerosis. Brain. 1994;117:1311-1322.
FREE FULL TEXT
 CiteULike  Connotea  Del.icio.us  Digg  Reddit  Technorati
What's this?
RELATED ARTICLE
Archives of Neurology Reader's Choice: Continuing Medical Education
Arch Neurol. 1999;56(3):370-371.
FULL TEXT
THIS ARTICLE HAS BEEN CITED BY OTHER ARTICLES
|
Autoantibody Profiling in Multiple Sclerosis Reveals Novel Antigenic Candidates
Somers et al.
J. Immunol. 2008;180:3957-3963.
ABSTRACT
| FULL TEXT
Myelin oligodendrocyte glycoprotein antibodies in pathologically proven multiple sclerosis: frequency, stability and clinicopathologic correlations
Pittock et al.
Mult Scler 2007;13:7-16.
ABSTRACT
Antimyelin antibodies and the risk of relapse in patients with a primary demyelinating event.
Rauer et al.
J. Neurol. Neurosurg. Psychiatry 2006;77:739-742.
ABSTRACT
| FULL TEXT
Antibodies from Inflamed Central Nervous System Tissue Recognize Myelin Oligodendrocyte Glycoprotein
O'Connor et al.
J. Immunol. 2005;175:1974-1982.
ABSTRACT
| FULL TEXT
Methodologic Factors Affect the Measurement of Anti-basal Ganglia Antibodies
Rippel et al.
Annals of Clinical & Laboratory Science 2005;35:121-130.
ABSTRACT
| FULL TEXT
Anti-MOG autoantibodies in Italian multiple sclerosis patients: specificity, sensitivity and clinical association
Mantegazza et al.
Int Immunol 2004;16:559-565.
ABSTRACT
| FULL TEXT
Antibody Cross-Reactivity between Myelin Oligodendrocyte Glycoprotein and the Milk Protein Butyrophilin in Multiple Sclerosis
Guggenmos et al.
J. Immunol. 2004;172:661-668.
ABSTRACT
| FULL TEXT
Activity profile in multiple sclerosis: an integrative approach A preliminary report
Zabaleta et al.
Mult Scler 2002;8:343-349.
ABSTRACT
Molecular characterization of antibody specificities against myelin/oligodendrocyte glycoprotein in autoimmune demyelination
von Budingen et al.
Proc. Natl. Acad. Sci. USA 2002;99:8207-8212.
ABSTRACT
| FULL TEXT
Antigen Discovery in Chronic Human Inflammatory Central Nervous System Disease: Panning Phage-Displayed Antigen Libraries Identifies the Targets of Central Nervous System-Derived IgG in Subacute Sclerosing Panencephalitis
Burgoon et al.
J. Immunol. 2001;167:6009-6014.
ABSTRACT
| FULL TEXT
Clinical, radiological, immunological and pathological findings in inflammatory CNS demyelination-possible markers for an antibody-mediated process
Bruck et al.
Mult Scler 2001;7:173-177.
ABSTRACT
Anti-DNA antibodies are a major component of the intrathecal B cell response in multiple sclerosis
Williamson et al.
Proc. Natl. Acad. Sci. USA 2001;98:1793-1798.
ABSTRACT
| FULL TEXT
|
